A1CF Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84322-4-RR (same clone as 84322-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84322-4-RR (A1CF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84322-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 84322-4-RR (same clone as 84322-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84322-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 84322-4-RR (same clone as 84322-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84322-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84322-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84322-4-RR against Human A1CF were performed. The affinity constant is 0.191 nM.

A1CF Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84322-4-PBS

Clone No.241644F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

APOBEC1CF, APOBEC1 complementation factor, ACF65, ACF64, ACF

---

Product Information

84322-4-PBS targets A1CF in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22929

  Product name: Recombinant human A1CF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC054873

  Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR

• Full Name: APOBEC1 complementation factor
• Calculated Molecular Weight: 594 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC054873
• Gene Symbol: A1CF
• Gene ID (NCBI): 29974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NQ94
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.