Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human pancreas cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25900-1-AP targets ADAM10 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23078 Product name: Recombinant human ADAM10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 306-512 aa of BC126253 Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV Predict reactive species |
| Full Name | ADAM metallopeptidase domain 10 |
| Calculated Molecular Weight | 748 aa, 84 kDa |
| Observed Molecular Weight | 60-70 kDa, 90 kDa |
| GenBank Accession Number | BC126253 |
| Gene Symbol | ADAM10 |
| Gene ID (NCBI) | 102 |
| RRID | AB_2880291 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14672 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ADAM10 antibody 25900-1-AP | Download protocol |
| WB protocol for ADAM10 antibody 25900-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ADAM10 Polyclonal antibody (Cat# 25900-1-AP) has 42 citations published in journals including Cell, Neuron, Nature Communications, Signal Transduction and Targeted Therapy, Aging Cell, Journal of Neuroscience, Journal of Biological Chemistry, Cell Reports, Frontiers in Immunology, Translational Psychiatry, and Geroscience. Research fields span neurodegeneration (Alzheimer's, Parkinson's), oncology (lung, breast, gastric, pancreatic cancer), immunology and inflammation, cardiovascular disease, diabetes, and aging.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Social memory maintenance relies on social interaction-induced proteolytic products of neuroligin 1. | ||
Cell Elucidating pathway-selective biased CCKBR agonism for Alzheimer's disease treatment. | ||
Nat Commun ADAM9 promotes type I interferon-mediated innate immunity during encephalomyocarditis virus infection | ||
J Adv Res Luteolin as a novel therapeutic for diabetic kidney disease: Targeting the ADAM10-TREM2 pathway. | ||
Neuron Maternal-fetal type I interferon signaling drives TREM2 dysregulation and synaptic dysfunction in neurodevelopmental disorders. | ||
Reviews
What customers say
All four reviewers used this antibody for Western Blot at 1:1000 dilution and reported positive results across diverse samples including Jurkat cells, mouse liver, brain tissue, and human neuroblastoma. Three gave 5-star ratings, highlighting strong signal with minimal non-specific bands. One reviewer (4 stars) noted that while the antibody produces clear bands at the expected molecular weight, it may require longer exposure times and suggested 1:500 as an alternative dilution. Overall, users consider it one of the better ADAM10 antibodies available after comparing multiple options.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jean-Baptiste (Verified Customer) (09-13-2026) | The antibody works at the dilution specified by the supplier in a Western blot
|
Angelique (Verified Customer) (02-03-2025) | used in western-blot (o/n 4°C 1/1000) on mouse livers and liver tumors. Strong signal, few non-specific band
![]() |
Xiaoyu (Verified Customer) (02-07-2024) | Good signal
![]() |
David (Verified Customer) (09-02-2019) | Used for immunoblot at 1:1000 which gives good, clear bands at the expected molecular weight, but does require long exposure times (30µg total protein, 10-15 minutes exposure). 1:500 would probably be a better dilution and this will be used for future experiments. It can be difficult to obtain good ADAM10 antibodies, but after trying several, this is the best.
|













