Home
Products
Primary Antibodies
Recombinant Antibodies
AGER/RAGE Recombinant monoclonal antibody (83759-5-RR)

AGER/RAGE Recombinant monoclonal antibody

AGER/RAGE Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83759-5-RR

Clone No. 240706C3

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

AGER, RAGE, 240706C3, Advanced glycosylation end product-specific receptor

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PAffinity

WB analysis using 83759-5-RR
Various lysates were subjected to SDS PAGE followed by western blot with 83759-5-RR (RAGE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 83759-5-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83759-5-RR (RAGE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 83759-5-RR
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83759-5-RR (RAGE antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat lung using 83759-5-RR
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83759-5-RR (AGER/RAGE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat lung using 83759-5-RR
Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83759-5-RR (AGER/RAGE antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse lung using 83759-5-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (83759-5-RR, Clone: 240706C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse lung using 83759-5-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (83759-5-RR, Clone: 240706C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 83759-5-RR
Biolayer interferometry (BLl) kinetic assays of 83759-5-RR against Rat AGER/RAGE were performed. The affinity constant is 3.46 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGER/RAGE in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse colon tissue, mouse heart tissue
Positive IHC detected in	mouse lung tissue, rat lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse lung tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)-P	IF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83759-5-RR targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity	mouse, rat
Cited Reactivity	mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1135 Product name: Recombinant Rat AGER/RAGE protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6HIS Tag: C-6HIS Domain: 23-341 aa of Sequence: GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL Predict reactive species
Full Name	advanced glycosylation end product-specific receptor
Calculated Molecular Weight	43 kDa
Observed Molecular Weight	43 kDa
Gene Symbol	Ager
Gene ID (NCBI)	81722
RRID	AB_3671355
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purfication
UNIPROT ID	Q63495
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).

Protocols

Product Specific Protocols
IF protocol for AGER/RAGE antibody 83759-5-RR	Download protocol
IHC protocol for AGER/RAGE antibody 83759-5-RR	Download protocol
WB protocol for AGER/RAGE antibody 83759-5-RR	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AGER/RAGE Recombinant monoclonal antibody (240706C3), catalog number 83759-5-RR, has 2 total citations. These appear in Chin Med (IF 7.4) and Front Endocrinol (Lausanne) (IF 5.7). The research fields covered include diabetic kidney disease involving inflammation, gut microbiota-bile acid axis, and FXR signaling pathway in mice, as well as osteoporosis treatment mechanisms explored through network pharmacology and molecular docking in rats. Both citations used the antibody for Western blot applications.

Species	Application	Title
mouse	WB	Chin Med Yiqi Wenyang Formula ameliorates diabetic kidney disease via inhibiting inflammation and regulating the gut microbiota-bile acid axis in mice by FXR signaling pathway. Authors - Tongyi Yuan View Article
rat	WB	Front Endocrinol (Lausanne) Exploring the mechanism of Heidihuang Pill in the treatment of osteoporosis based on network pharmacology, molecular docking, and experimental validation. Authors - Zenghui Tian View Article