Rat AGER/RAGE Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83759-5-RR (same clone as 83759-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83759-5-RR (RAGE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83759-5-RR (RAGE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 83759-5-RR (RAGE antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83759-5-RR (AGER/RAGE antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 83759-5-RR (AGER/RAGE antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (83759-5-RR, Clone: 240706C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 83759-5-RR (same clone as 83759-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using AGER/RAGE antibody (83759-5-RR, Clone: 240706C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83759-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83759-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83759-5-RR against Rat AGER/RAGE were performed. The affinity constant is 3.46 nM.

AGER/RAGE Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 83759-5-PBS

Clone No.240706C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

AGER, RAGE, 240706C3, Advanced glycosylation end product-specific receptor

---

Product Information

83759-5-PBS targets AGER/RAGE in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1135

  Product name: Recombinant Rat AGER/RAGE protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-341 aa of

  Sequence: GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• Gene Symbol: Ager
• Gene ID (NCBI): 81722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q63495
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).