Rat AGER/RAGE Recombinant monoclonal antibody, PBS Only

AGER/RAGE Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 83759-5-PBS
Clone No.240706C3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

AGER, RAGE, 240706C3, Advanced glycosylation end product-specific receptor

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83759-5-PBS targets AGER/RAGE in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1135

Product name: Recombinant Rat AGER/RAGE protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-341 aa of

Sequence: GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL

Predict reactive species
Full Name advanced glycosylation end product-specific receptor
Calculated Molecular Weight43 kDa
Observed Molecular Weight43 kDa
Gene Symbol Ager
Gene ID (NCBI) 81722
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ63495
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).

Loading...
||
New chat Able
正在加载,请稍候...