AGPAT2 Recombinant monoclonal antibody

AGPAT2 Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83349-3-RR
Clone No.240153C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

240153C2, 1-AGPAT 2, 1-AGP acyltransferase 2, 1-acyl-sn-glycerol-3-phosphate acyltransferase beta, 1-acylglycerol-3-phosphate O-acyltransferase 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, THP-1 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83349-3-RR targets AGPAT2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34761

Product name: Recombinant human AGPAT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 201-279 aa of BC019292

Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ

Predict reactive species
Full Name 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
Calculated Molecular Weight 31 kDa
Observed Molecular Weight27 kDa
GenBank Accession NumberBC019292
Gene Symbol AGPAT2
Gene ID (NCBI) 10555
RRIDAB_3671007
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15120
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa.

Protocols

Product Specific Protocols
WB protocol for AGPAT2 antibody 83349-3-RRDownload protocol
IHC protocol for AGPAT2 antibody 83349-3-RRDownload protocol
FC protocol for AGPAT2 antibody 83349-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...