AIFM2/ FSP1 Recombinant monoclonal antibody

AIFM2/ FSP1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 82974-1-RR
Clone No.2J1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, ELISA

AMID, AIFM2, FSP1, Apoptosis-inducing factor homologous mitochondrion-associated inducer of death, Apoptosis inducing factor 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells
Positive IP detected inHepG2 cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82974-1-RR targets AIFM2/ FSP1 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13412

Product name: Recombinant human AIFM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-373 aa of BC023601

Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 2
Calculated Molecular Weight 41 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC023601
Gene Symbol AIFM2/ FSP1
Gene ID (NCBI) 84883
RRIDAB_3670722
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BRQ8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Protocols

Product Specific Protocols
WB protocol for AIFM2/ FSP1 antibody 82974-1-RRDownload protocol
IP protocol for AIFM2/ FSP1 antibody 82974-1-RRDownload protocol
FC protocol for AIFM2/ FSP1 antibody 82974-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...