• Featured Product
  • KD/KO Validated

AKR7A2 Monoclonal antibody

AKR7A2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66677-1-Ig
Clone No.2E1E8

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

AFAR, AFAR1, AFB1 aldehyde reductase 1, AFB1 AR 1, AFB1 AR1, AKR7, AKR7A2, Aldoketoreductase 7, SSA reductase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

66677-1-Ig targets AKR7A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26105

Product name: Recombinant human AKR7A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 60-359 aa of BC007352

Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

Predict reactive species
Full Name aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC007352
Gene Symbol AKR7A2
Gene ID (NCBI) 8574
RRIDAB_2882031
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43488
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKR7A2(Aflatoxin B1 aldehyde reductase member 2) is also named as AFAR, AFAR1, AKR7 and belongs to the aldo/keto reductase family. AKR7A2 enzyme is catalytically active toward aldehydes arising from lipid peroxidation, suggesting a potential role against the consequences of oxidative stress, and representing an important detoxication route in mammalian cells(PMID:22001351).

Protocols

Product Specific Protocols
IF protocol for AKR7A2 antibody 66677-1-IgDownload protocol
IHC protocol for AKR7A2 antibody 66677-1-IgDownload protocol
WB protocol for AKR7A2 antibody 66677-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Chem Biol Interact

Aldo-keto reductase-7A2 protects against atorvastatin-induced hepatotoxicity via Nrf2 activation

Authors - Dan Li
Loading...
||
New chat Able
正在加载,请稍候...