ALKBH3 Recombinant monoclonal antibody

ALKBH3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 84314-2-RR
Clone No.241650F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

241650F10, ABH3, Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, DEPC 1, DEPC1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, mouse kidney tissue, SGC-7901 cells, mouse heart tissue, rat heart tissue
Positive FC (Intra) detected inPC-3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84314-2-RR targets ALKBH3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2982

Product name: Recombinant human ALKBH3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 148-286 aa of BC015155

Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Predict reactive species
Full Name alkB, alkylation repair homolog 3 (E. coli)
Calculated Molecular Weight 286 aa, 33 kDa
Observed Molecular Weight30-33 kDa
GenBank Accession NumberBC015155
Gene Symbol ALKBH3
Gene ID (NCBI) 221120
RRIDAB_3671855
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96Q83
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa.

Protocols

Product Specific Protocols
FC protocol for ALKBH3 antibody 84314-2-RRDownload protocol
WB protocol for ALKBH3 antibody 84314-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...