APOH Monoclonal antibody

APOH Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 66074-1-Ig
Clone No.4D9A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, Neutralization, ELISA

Apolipoprotein H, 4D9A4, Activated protein C-binding protein, Apo H, Apo-H

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma, human testis tissue, pig plasma, human heart tissue, pig heart tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:100-1:800
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 5 publications below

Product Information

66074-1-Ig targets APOH in WB, IHC, IF/ICC, IF-P, Neutralization, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17915

Product name: Recombinant human APOH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 21-345 aa of BC026283

Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Predict reactive species
Full Name apolipoprotein H (beta-2-glycoprotein I)
Calculated Molecular Weight 345 aa, 38 kDa
Observed Molecular Weight 50-53 kDa
GenBank Accession NumberBC026283
Gene Symbol APOH
Gene ID (NCBI) 350
RRIDAB_11182392
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02749
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins.

Protocols

Product Specific Protocols
IF protocol for APOH antibody 66074-1-IgDownload protocol
IHC protocol for APOH antibody 66074-1-IgDownload protocol
WB protocol for APOH antibody 66074-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Thromb Haemost

Identification of APOH polymorphisms as common genetic risk factors for venous thrombosis in the Chinese population.

Authors - Liang Tang
humanWB

Curr Med Sci

Thrombophilia Caused by Beta2-Glycoprotein I Deficiency: In Vitro Study of a Rare Mutation in APOH Gene.

Authors - Xiao-Ping Zhang
mouseWB,Neutralization

Crit Care

The protective effect of apolipoprotein H in paediatric sepsis

Authors - Zhicai Yu
mouseWB

Biomedicines

Identification of Potential Drug Targets for Antiplatelet Therapy Specifically Targeting Platelets of Old Individuals through Proteomic Analysis

Authors - Seung Hee Lee
mouseWB

Cell Death Dis

Serum apolipoprotein H determines ferroptosis resistance by modulating cellular lipid composition

Authors - Xiang He
Loading...
||
New chat Able
正在加载,请稍候...