APOH Monoclonal antibody, PBS Only

• 

  WB analysis using 66074-1-Ig (same clone as 66074-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 66074-1-Ig (same clone as 66074-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 66074-1-Ig (same clone as 66074-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig plasma using 66074-1-Ig (same clone as 66074-1-PBS)

  pig plasma were subjected to SDS PAGE followed by western blot with 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66074-1-Ig (Apolipoprotein H antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 66074-1-Ig(Apolipoprotein H antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 66074-1-Ig(Apolipoprotein H antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using Apolipoprotein H antibody (66074-1-Ig, Clone: 4D9A4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66074-1-Ig (same clone as 66074-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Apolipoprotein H antibody (66074-1-Ig, Clone: 4D9A4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66074-1-PBS in a different storage buffer formulation.

APOH Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66074-1-PBS

Clone No.4D9A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Apolipoprotein H, 4D9A4, Activated protein C-binding protein, Apo H, Apo-H

---

Product Information

66074-1-PBS targets APOH in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17915

  Product name: Recombinant human APOH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 21-345 aa of BC026283

  Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

• Full Name: apolipoprotein H (beta-2-glycoprotein I)
• Calculated Molecular Weight: 345 aa, 38 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: BC026283
• Gene Symbol: APOH
• Gene ID (NCBI): 350
• RRID: AB_11182392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins.