Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, A431 cells, HCT 116 cells, Jurkat cells, Ramos cells, Raji cells |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85848-1-RR targets ASF1B in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17763 Product name: Recombinant human ASF1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-202 aa of BC010014 Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI Predict reactive species |
| Full Name | ASF1 anti-silencing function 1 homolog B (S. cerevisiae) |
| Calculated Molecular Weight | 202 aa, 22 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC010014 |
| Gene Symbol | ASF1B |
| Gene ID (NCBI) | 55723 |
| RRID | AB_3744419 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NVP2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody reacts with the ASF1B and ASF1A protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ASF1B antibody 85848-1-RR | Download protocol |
| WB protocol for ASF1B antibody 85848-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









