Use Able AI chat for product recommendations
  • Featured Product

ATF6 Monoclonal antibody

ATF6 antibodies are primarily used to investigate endoplasmic reticulum stress and the unfolded protein response by detecting ATF6 activation in cells and tissues. Proteintech has an extensive range of ATF6 antibodies validated for WB, IHC, IF/ICC, FC (Intra), IP, ELISA and more.

Cat No. 66563-1-Ig
Clone No.3B7E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

3B7E4, activating transcription factor 6, ATF 6, ATF6 alpha, ATF6A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HeLa cells, HEK-293 cells, 4T1 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman cervical cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66563-1-Ig targets ATF6 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21456

Product name: Recombinant human ATF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC014969

Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT

Predict reactive species
Full Name activating transcription factor 6
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC014969
Gene Symbol ATF6
Gene ID (NCBI) 22926
RRIDAB_2881924
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.

Protocols

Product Specific Protocols
FC protocol for ATF6 antibody 66563-1-IgDownload protocol
IF protocol for ATF6 antibody 66563-1-IgDownload protocol
IHC protocol for ATF6 antibody 66563-1-IgDownload protocol
WB protocol for ATF6 antibody 66563-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Protein Cell

POST1/C12ORF49 regulates the SREBP pathway by promoting site-1 protease maturation.

Authors - Jian Xiao
mouseWB

J Cell Biol

Antigen-derived peptides engage the ER stress sensor IRE1α to curb dendritic cell cross-presentation.

Authors - Ofer Guttman
humanWB

Cell Rep

CD44 correlates with longevity and enhances basal ATF6 activity and ER stress resistance

Authors - Masaki Takasugi
humanWB

Elife

Endoplasmic reticulum stress activates human IRE1α through reversible assembly of inactive dimers into small oligomers.

Authors - Vladislav Belyy
humanWB

Mol Oncol

The synthetic oleanane triterpenoid CDDO-2P-Im binds GRP78/BiP to induce unfolded protein response-mediated apoptosis in myeloma

Authors - George Luo
humanWB,IF

J Inflamm (Lond)

Soluble epoxide hydrolase deficiency attenuates airway inflammation in COPD via IRE1α/JNK/AP-1 signaling pathway

Authors - Yue Yu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Vignesh (Verified Customer) (09-19-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEPG2A cells
Loading...
||
New chat

Able™

正在加载,请稍候...