• Featured Product
  • KD/KO Validated

ATF6 Recombinant monoclonal antibody

ATF6 antibodies are primarily used to investigate endoplasmic reticulum stress and the unfolded protein response by detecting ATF6 activation in cells and tissues. Proteintech has an extensive range of ATF6 antibodies validated for WB, IHC, IF/ICC, FC (Intra), IP, ELISA and more.
Cat No. 82278-1-RR
Clone No.2O8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

2O8, activating transcription factor 6, ATF 6, ATF6 alpha, ATF6A

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, MCF-7 cells, Jurkat cells, K-562 cells
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82278-1-RR targets ATF6 in WB, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21456

Product name: Recombinant human ATF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC014969

Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT

Predict reactive species
Full Name activating transcription factor 6
Calculated Molecular Weight 75 kDa
Observed Molecular Weight90-100 kDa
GenBank Accession NumberBC014969
Gene Symbol ATF6
Gene ID (NCBI) 22926
RRIDAB_3086474
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159).

Protocols

Product Specific Protocols
WB protocol for ATF6 antibody 82278-1-RRDownload protocol
IP protocol for ATF6 antibody 82278-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...