ATOX1 Recombinant monoclonal antibody

ATOX1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83785-6-RR
Clone No.240679E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

ATX1, ATOX 1, Antioxidant 1, 240679E9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, A549 cells, HEK-293 cells, NCI-H1299 cells, HepG2 cells, Jurkat cells
Positive FC (Intra) detected inHeLa cells, PC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83785-6-RR targets ATOX1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18460

Product name: Recombinant human ATOX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-68 aa of BC112248

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Predict reactive species
Full Name ATX1 antioxidant protein 1 homolog (yeast)
Calculated Molecular Weight 68 aa, 8 kDa
Observed Molecular Weight 7 kDa
GenBank Accession NumberBC112248
Gene Symbol ATOX1
Gene ID (NCBI) 475
RRIDAB_3671377
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO00244
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143).

Protocols

Product Specific Protocols
FC protocol for ATOX1 antibody 83785-6-RRDownload protocol
WB protocol for ATOX1 antibody 83785-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...