ATP5H Recombinant monoclonal antibody

ATP5H Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 86174-2-RR
Clone No.250751G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

ATP synthase peripheral stalk subunit d, ATP5, ATP5JD, ATP5PD, ATPQ

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, Jurkat cells, Ramos cells, SK-BR-3 cells, PANC-1 cells, mouse liver tissue, rat liver tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86174-2-RR targets ATP5H in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11429

Product name: Recombinant human ATP5H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-137 aa of BC032245

Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d
Calculated Molecular Weight 137 aa, 16 kDa
Observed Molecular Weight 19-22 kDa
GenBank Accession NumberBC032245
Gene Symbol ATP5H
Gene ID (NCBI) 10476
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75947
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5H gene encodes ATP synthase subunit d of the Fo complex.

Protocols

Product Specific Protocols
IF protocol for ATP5H antibody 86174-2-RRDownload protocol
WB protocol for ATP5H antibody 86174-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...