BCDIN3D Recombinant monoclonal antibody

BCDIN3D Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 83309-1-RR
Clone No.240152A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

240152A9, BCDIN3 domain-containing protein, EC:2.1.1.-, RNA 5'-monophosphate methyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SH-SY5Y cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83309-1-RR targets BCDIN3D in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15613

Product name: Recombinant human BCDIN3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-292 aa of BC053560

Sequence: MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFPESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAEKECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLWEFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQDHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ

Predict reactive species
Full Name BCDIN3 domain containing
Calculated Molecular Weight 292 aa, 33 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC053560
Gene Symbol BCDIN3D
Gene ID (NCBI) 144233
RRIDAB_3670975
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z5W3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCDIN3D (BCDIN3 domain containing RNA methyltransferase), it is expected to be located in cytoplasm, which is ubiquitous expressed in prostate, lymph node and skeletal muscle. This gene encodes an RNA methyltransferase which belongs to the rossmann fold methyltransferase family and serves as a 5'-methylphosphate capping enzyme that is specific for cytoplasmic histidyl tRNA. The encoded protein contains an S-adenosylmethionine binding domain and uses the methyl group donor, S-adenosylmethionine. This gene is overexpressed in breast cancer cells, and is related to the tumorigenic phenotype and poor prognosis of breast cancer. The encoded protein is thought to promote the cellular invasion of breast cancer cells, by downregulating the expression of tumor suppressor miRNAs through the dimethylation of the 5-monophosphate of the corresponding precursor miRNAs. The molecular weight of BCDIN3D is 33 kDa.

Protocols

Product Specific Protocols
FC protocol for BCDIN3D antibody 83309-1-RRDownload protocol
WB protocol for BCDIN3D antibody 83309-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...