Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, MCF-7 cells, SGC-7901 cells, mouse brain tissue |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27286-1-AP targets BCRP/ABCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species |
| Full Name | ATP-binding cassette, sub-family G (WHITE), member 2 |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 68-72 kDa |
| GenBank Accession Number | BC021281 |
| Gene Symbol | ABCG2 |
| Gene ID (NCBI) | 9429 |
| RRID | AB_2880830 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UNQ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for BCRP/ABCG2 antibody 27286-1-AP | Download protocol |
| WB protocol for BCRP/ABCG2 antibody 27286-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
BCRP/ABCG2 Polyclonal antibody (Cat# 27286-1-AP) has accumulated 103 citations across 50+ journals, including Mol Cancer, Cell Death Dis, Drug Resist Updat, Phytomedicine, J Ethnopharmacol, and Food Funct. Key research fields include cancer biology (multidrug resistance, cancer stemness, ferroptosis), hyperuricemia and gout, urate transporter regulation, renal injury, gut microbiome modulation, and tissue repair.
| Species | Application | Title |
|---|---|---|
Mol Cancer Hsa-miR-3178/RhoB/PI3K/Akt, a novel signaling pathway regulates ABC transporters to reverse gemcitabine resistance in pancreatic cancer. | ||
Bioact Mater Engineering multifunctional chitosan-based hydrogels for integrated antimicrobial therapy and endogenous stem cell-driven tissue repair in infectious keratitis. | ||
Drug Resist Updat YTHDF2-mediated m6A modification of ONECUT2 promotes stemness and oxaliplatin resistance in gastric cancer through transcriptionally activating TFPI | ||
Drug Resist Updat Cell membrane-camouflaged bufalin targets NOD2 and overcomes multidrug resistance in pancreatic cancer | ||
Drug Resist Updat AMPKα2 attenuates doxorubicin induced ferroptosis by promoting NCOA4 degradation in triple negative breast cancer. | ||
Theranostics CD146(+) pericyte-like lung cancer brain metastatic stem cells promote tumor angiogenesis through dual regulatory effects on the VEGF/VEGFR axis. |
Reviews
What customers say
Users report this antibody performs well in Western Blot across various cell lines and tissues, including human organoids, SW620/SW480, A2780, and U2OS cells. Most reviewers rate it 4–5 stars, praising low background staining and clear detection of the expected ~75 kDa band. Recommended dilutions range from 1:500 to 1:3000. One user noted multiple bands, though this was likely attributed to sample preparation rather than the antibody itself. Overall, it is considered a reliable reagent for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | Very good antibody
|
Yogain (Verified Customer) (12-19-2025) | Antibody works really well for western blot.
|
Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4 C. Incubation with secondary antibody (rabbit) 2h at RT.
|
Caitlin (Verified Customer) (07-12-2024) | The antibody worked well in that there was minimal background staining. However, the protein shows as multiple bands. Although, this is possibly due to a protein preparation issue rather than an antibody issue
|
Udesh (Verified Customer) (09-12-2022) | Used in Western Blot at 1:3000 Dilution and it detected a band at 75 kDa.
 |
