Tested Applications
| Positive WB detected in | HEK-293 cells, U-251 cells, MCF-7 cells, SGC-7901 cells, HepG2 cells, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83835-1-RR targets BCRP/ABCG2 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25911 Product name: Recombinant human BCRP,ABCG2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 557-630 aa of BC021281 Sequence: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH Predict reactive species |
| Full Name | ATP-binding cassette, sub-family G (WHITE), member 2 |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 68-72 kDa |
| GenBank Accession Number | BC021281 |
| Gene Symbol | ABCG2 |
| Gene ID (NCBI) | 9429 |
| RRID | AB_3671417 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UNQ0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BCRP (breast cancer resistance protein) confers a broad spectrum of drug resistance and the expression of BCRP is enhanced in several cancer cell models. It has ATPase activity and belongs to a family of multiple drug resistant proteins. Data also indicated that BCRP might be an early marker for some stem cells.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for BCRP/ABCG2 antibody 83835-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BCRP/ABCG2 Recombinant monoclonal antibody (240959A4), catalog number 83835-1-RR, has 3 total citations. These appear in Phytomedicine, J Ethnopharmacol, and Food Funct. The research fields span breast cancer chemosensitization via GSK-3β/β-catenin/CXCL1 signaling, hyperuricemia amelioration through the PGC-1α/PPARγ/ABCG2 pathway, and gout-related uric acid homeostasis with inflammatory response suppression. All citations used the antibody for Western blot in human, mouse, or rat samples.
| Species | Application | Title |
|---|---|---|
Phytomedicine The chemosensitizing activity of betulinic acid in suppressing macrophage polarization through GSK-3β/β-catenin/CXCL1 signaling in breast cancer. | ||
J Ethnopharmacol The mechanism of honeysuckle peptides in ameliorating hyperuricemia in mice via the PGC-1α/PPARγ/ABCG2 pathway. | ||
Food Funct Multi-strategy profiling identifies limonin's dual role in gout: restoring uric acid homeostasis and suppressing inflammatory response. |
