C9orf89 Recombinant monoclonal antibody

C9orf89 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85357-1-RR
Clone No.242638F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

242638F7, Bcl10-interacting CARD protein, BinCARD, CARD19, Caspase recruitment domain-containing protein 19

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, C2C12 cells, H9C2 cells, rat kidney tissue, mouse kidney tissue, human placenta tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85357-1-RR targets C9orf89 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14084

Product name: Recombinant human C9orf89 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-183 aa of BC004500

Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL

Predict reactive species
Full Name chromosome 9 open reading frame 89
Calculated Molecular Weight 228 aa, 26 kDa
Observed Molecular Weight15-21 kDa
GenBank Accession NumberBC004500
Gene Symbol C9orf89
Gene ID (NCBI) 84270
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96LW7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses.

Protocols

Product Specific Protocols
IF protocol for C9orf89 antibody 85357-1-RRDownload protocol
IHC protocol for C9orf89 antibody 85357-1-RRDownload protocol
WB protocol for C9orf89 antibody 85357-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...