CoraLite® Plus 488-conjugated C9orf89 Recombinant monoclonal antibody

C9orf89 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85357
Clone No.242638F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Bcl10-interacting CARD protein, BinCARD, CARD19, Caspase recruitment domain-containing protein 19

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85357 targets C9orf89 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14084

Product name: Recombinant human C9orf89 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-183 aa of BC004500

Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL

Predict reactive species
Full Name chromosome 9 open reading frame 89
Calculated Molecular Weight 228 aa, 26 kDa
Observed Molecular Weight15-21 kDa
GenBank Accession NumberBC004500
Gene Symbol C9orf89
Gene ID (NCBI) 84270
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96LW7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

C9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses.

Loading...
||
New chat Able
正在加载,请稍候...