CoraLite® Plus 488-conjugated C9orf89 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-85357

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 C9orf89 antibody (CL488-85357, Clone: 242638F7 ) at dilution of 1:200, CL594-phalloidin (red).

C9orf89 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85357

Clone No.242638F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Bcl10-interacting CARD protein, BinCARD, CARD19, Caspase recruitment domain-containing protein 19

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85357 targets C9orf89 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14084

  Product name: Recombinant human C9orf89 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC004500

  Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL

• Full Name: chromosome 9 open reading frame 89
• Calculated Molecular Weight: 228 aa, 26 kDa
• Observed Molecular Weight: 15-21 kDa
• GenBank Accession Number: BC004500
• Gene Symbol: C9orf89
• Gene ID (NCBI): 84270
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96LW7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

C9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses.