• Featured Product
  • KD/KO Validated

calreticulin Polyclonal antibody

calreticulin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 10292-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), CoIP, ELISA

CALR, Calregulin, CRT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, A549 cells, mouse brain tissue, COLO 320 cells, NIH/3T3 cells, human skeletal muscle tissue, rat brain tissue, HeLa cells, HepG2 cells, MCF-7 cells, SH-SY5Y cells
Positive IHC detected inhuman thyroid tissue, human normal colon, human skeletal muscle tissue, human thyroid cancer tissue, mouse colon tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0325

Product name: Recombinant human calreticulin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC002500

Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW

Predict reactive species
Full Name calreticulin
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC002500
Gene Symbol Calreticulin
Gene ID (NCBI) 811
RRIDAB_2069615
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27797
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Protocols

Product Specific Protocols
FC protocol for calreticulin antibody 10292-1-APDownload protocol
IHC protocol for calreticulin antibody 10292-1-APDownload protocol
WB protocol for calreticulin antibody 10292-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

ACS Nano

ER-Targeting PDT Converts Tumors into In Situ Therapeutic Tumor Vaccines.

Authors - Xu Liu
mouseWB

ACS Nano

Nanointegrative In Situ Reprogramming of Tumor-Intrinsic Lipid Droplet Biogenesis for Low-Dose Radiation-Activated Ferroptosis Immunotherapy

Authors - Qiqi Zhang
mouse

ACS Nano

Starting the Engine and Releasing the Brakes of T-Cell Responses: A Biomimetic Dendritic Cell Nanoplatform for Improved Glioblastoma Immunotherapy

Authors - Lei Kuang

ACS Nano

An Implantable Double-Layered Spherical Scaffold Depositing Gene and Cell Agents to Facilitate Collaborative Cancer Immunotherapy

Authors - Sibei Lei
humanWB

Cell Res

DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.

Authors - Pengli Zheng

Adv Sci (Weinh)

Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine

Authors - Jiaxin Huang
Loading...
||
New chat Able
正在加载,请稍候...