Use Able AI chat for product recommendations

CD133 Monoclonal antibody

CD133 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66666-1-Ig
Clone No.2B8A2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

2B8A2, AC133, Antigen AC133, CORD12, MCDR2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, Caco-2 cells
Positive IHC detected inhuman kidney tissue, human breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66666-1-Ig targets CD133 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13327

Product name: Recombinant human CD133 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 505-782 aa of BC012089

Sequence: LICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPL

Predict reactive species
Full Name prominin 1
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 115 kDa, 80-90 kDa
GenBank Accession NumberBC012089
Gene Symbol CD133
Gene ID (NCBI) 8842
RRIDAB_2801586
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43490
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).

Protocols

Product Specific Protocols
IF protocol for CD133 antibody 66666-1-IgDownload protocol
IHC protocol for CD133 antibody 66666-1-IgDownload protocol
WB protocol for CD133 antibody 66666-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIHC

Cancer Res

Targeting CD44 variant 5 with an antibody-drug conjugate is an effective therapeutic strategy for intrahepatic cholangiocarcinoma

Authors - Yuncheng Bei
humanWB,IF

J Exp Clin Cancer Res

Pharmacological targeting PTK6 inhibits the JAK2/STAT3 sustained stemness and reverses chemoresistance of colorectal cancer.

Authors - Chaoqun Liu
humanWB,IF

J Exp Clin Cancer Res

ISG15 and ISGylation modulates cancer stem cell-like characteristics in promoting tumor growth of anaplastic thyroid carcinoma

Authors - Tong Xu
humanWB

J Exp Clin Cancer Res

Gemcitabine-induced β4 integrin drives cancer progression and gemcitabine resistance in pancreatic cancer.

Authors - Yoshinobu Kariya
humanWB

Adv Sci (Weinh)

CDKAL1 Drives the Maintenance of Cancer Stem-Like Cells by Assembling the eIF4F Translation Initiation Complex

Authors - Rongsheng Huang
humanIF

Adv Sci (Weinh)

SLPI⁺ AT2-Like Cells Orchestrate Lung Adenocarcinoma Invasion via Wnt Pathway Activation and Stromal Crosstalk in a Spatially Defined Margin Niche.

Authors - Zhoufeng Wang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Udesh (Verified Customer) (08-16-2023)

Worked well in WB at 1:1000

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glioblastoma cells
Loading...
||
New chat

Able

正在加载,请稍候...