Tested Applications
| Positive WB detected in | human placenta tissue, human ovary cancer cells, human uterus tissue, human testis tissue |
| Positive IHC-Autostainer detected in | human colorectal cancer tissue, human liver cancer tissue, human appendicitis tissue, human pancreas cancer tissue, human pancreas tissue, human ovary cancer tissue |
| Positive IHC detected in | human tonsillitis tissue, human appendicitis tissue, human liver tissue, human liver cancer tissue, human breast cancer tissue, human ovary cancer tissue, human pancreas tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60180-2-Ig targets CD34 in WB, IHC, IHC-Autostainer, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5996 Product name: Recombinant human CD34 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 34-287 aa of BC039146 Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS Predict reactive species |
| Full Name | CD34 molecule |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 105 kDa |
| GenBank Accession Number | BC039146 |
| Gene Symbol | CD34 |
| Gene ID (NCBI) | 947 |
| RRID | AB_2881354 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P28906 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD34 antibody 60180-2-Ig | Download protocol |
| WB protocol for CD34 antibody 60180-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD34 Monoclonal antibody (4F11H3), catalog number 60180-2-Ig, has 4 total citations. These appear in Frontiers in Cellular Neuroscience, BMC Cancer, Frontiers in Oncology, and STAR Protocols. The associated research fields include neuroinflammation in Parkinson's disease, hepatocellular carcinoma anti-angiogenesis, lung adenocarcinoma prognostic analysis, and human cutaneous vasculature morphometric analysis.
| Species | Application | Title |
|---|---|---|
Front Cell Neurosci Decreased neuronal and increased endothelial fractalkine expression are associated with neuroinflammation in Parkinson's disease and related disorders | ||
BMC Cancer Novel fusion protein PK5-RL-Gal-3C inhibits hepatocellular carcinoma via anti-angiogenesis and cytotoxicity | ||
Front Oncol Prognostic Impact of the Angiogenic Gene POSTN and Its Related Genes on Lung Adenocarcinoma. | ||
STAR Protoc Skin-iDISCO+: An optimized tissue-clearing and labeling protocol for morphometric analysis of human cutaneous vasculature |

































































