CD34 Monoclonal antibody, PBS Only

CD34 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 60180-2-PBS
Clone No.4F11H3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

CD34 molecule, 4F11H3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60180-2-PBS targets CD34 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5996

Product name: Recombinant human CD34 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-287 aa of BC039146

Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS

Predict reactive species
Full Name CD34 molecule
Calculated Molecular Weight 41 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC039146
Gene Symbol CD34
Gene ID (NCBI) 947
RRIDAB_2881354
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP28906
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).

Loading...
||
New chat Able
正在加载,请稍候...