Tested Applications
| Positive WB detected in | RAW 264.7 cells |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A20 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85838-3-RR targets CD53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2684 Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 107-181 aa of NM_007651.3 Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN Predict reactive species |
| Full Name | CD53 antigen |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | NM_007651.3 |
| Gene Symbol | Cd53 |
| Gene ID (NCBI) | 12508 |
| RRID | AB_3744413 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q61451 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD53 antibody 85838-3-RR | Download protocol |
| IHC protocol for CD53 antibody 85838-3-RR | Download protocol |
| WB protocol for CD53 antibody 85838-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD53 Recombinant monoclonal antibody (250105D10), catalog number 85838-3-RR, has a total of 1 citation. It appears in Frontiers in Cell and Developmental Biology, where it was used in Western blot for mouse samples. The associated research explores common mechanisms and potential biomarkers between periodontitis and preterm birth using integrated bioinformatics and machine learning approaches.
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol Integrated bioinformatics and machine learning to explore the common mechanisms and potential biomarkers between periodontitis and preterm birth. |
