Tested Applications
| Positive WB detected in | MOLT-4 cells, human peripheral blood leukocyte |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue, human breast cancer tissue, human colon cancer tissue, human colon tissue, human lung cancer tissue, human pancreas cancer tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species |
| Full Name | CD8a molecule |
| Calculated Molecular Weight | 235 aa, 26 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC025715 |
| Gene Symbol | CD8A |
| Gene ID (NCBI) | 925 |
| ENSEMBL Gene ID | ENSG00000153563 |
| RRID | AB_2882205 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01732 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD8a antibody 66868-1-Ig | Download protocol |
| IHC protocol for CD8a antibody 66868-1-Ig | Download protocol |
| WB protocol for CD8a antibody 66868-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-PD-L1 antibody (Cat# 66868-1-Ig) has accumulated 334 citations published in high-impact journals including Nature Communications, Cancer Cell, Cell Metabolism, Nature Genetics, Cell Reports, Advanced Science, Oncogene, Journal of Clinical Investigation, and Frontiers in Immunology. Associated research fields encompass cancer immunotherapy and immune checkpoint blockade, tumor microenvironment remodeling, single-cell and spatial transcriptomics, ferroptosis, macrophage polarization, T cell exhaustion, radiotherapy resistance, CAR-T therapy, nanomedicine, gut microbiome–immune interactions, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy | ||
Cancer Cell Spatial determinants of antibody-drug conjugate SHR-A1811 efficacy in neoadjuvant treatment for HER2-positive breast cancer | ||
Cancer Cell Proteogenomic characterization of non-functional pancreatic neuroendocrine tumors unravels clinically relevant subgroups | ||
Mol Cancer The construction of modular universal chimeric antigen receptor T (MU-CAR-T) cells by covalent linkage of allogeneic T cells and various antibody fragments | ||
Mol Cancer ACOX2 destabilizes the MRE11-RAD50-NBS1 complex and boosts anticancer immunity via the cGAS-STING pathway in clear cell renal cell carcinoma. | ||
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer |
Reviews
What customers say
The single available review for 66868-1-Ig is a 5-star rating from November 2025. The reviewer used the antibody on liver tissue for immunofluorescence at a 1:100 dilution and reported it performed well for IF applications. Overall, the feedback is positive, indicating satisfactory staining results in their experimental setup.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-26-2025) | GODD FOR IF
|
