Use Able AI chat for product recommendations

CD8a Monoclonal antibody

CD8a Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66868-1-Ig
Clone No. 1G2B10
Publications (334)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

CD8, 1G2B10, CD8a molecule, Leu2, MAL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD8a in ?

Tested Applications

Positive WB detected inMOLT-4 cells, human peripheral blood leukocyte
Positive IHC detected inhuman tonsillitis tissue, human lymphoma tissue, human breast cancer tissue, human colon cancer tissue, human colon tissue, human lung cancer tissue, human pancreas cancer tissue, human appendicitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:10000-1:40000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11111

Product name: Recombinant human CD8A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-183 aa of BC025715

Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI

Predict reactive species
Full Name CD8a molecule
Calculated Molecular Weight 235 aa, 26 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC025715
Gene Symbol CD8A
Gene ID (NCBI) 925
ENSEMBL Gene IDENSG00000153563
RRIDAB_2882205
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01732
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.

Protocols

Product Specific Protocols
IF protocol for CD8a antibody 66868-1-IgDownload protocol
IHC protocol for CD8a antibody 66868-1-IgDownload protocol
WB protocol for CD8a antibody 66868-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-PD-L1 antibody (Cat# 66868-1-Ig) has accumulated 334 citations published in high-impact journals including Nature Communications, Cancer Cell, Cell Metabolism, Nature Genetics, Cell Reports, Advanced Science, Oncogene, Journal of Clinical Investigation, and Frontiers in Immunology. Associated research fields encompass cancer immunotherapy and immune checkpoint blockade, tumor microenvironment remodeling, single-cell and spatial transcriptomics, ferroptosis, macrophage polarization, T cell exhaustion, radiotherapy resistance, CAR-T therapy, nanomedicine, gut microbiome–immune interactions, and neurodegeneration.

SpeciesApplicationTitle
humanIF

Signal Transduct Target Ther

Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy

Authors - Xiao Hu
IF

Cancer Cell

Spatial determinants of antibody-drug conjugate SHR-A1811 efficacy in neoadjuvant treatment for HER2-positive breast cancer

Authors - Ding Ma
human

Cancer Cell

Proteogenomic characterization of non-functional pancreatic neuroendocrine tumors unravels clinically relevant subgroups

Authors - Shunrong Ji
IHC

Mol Cancer

The construction of modular universal chimeric antigen receptor T (MU-CAR-T) cells by covalent linkage of allogeneic T cells and various antibody fragments

Authors - Tao Chen
humanIHC

Mol Cancer

ACOX2 destabilizes the MRE11-RAD50-NBS1 complex and boosts anticancer immunity via the cGAS-STING pathway in clear cell renal cell carcinoma.

Authors - Shiqi Ye
humanIF

Cell Metab

Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer

Authors - Yu Jiang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single available review for 66868-1-Ig is a 5-star rating from November 2025. The reviewer used the antibody on liver tissue for immunofluorescence at a 1:100 dilution and reported it performed well for IF applications. Overall, the feedback is positive, indicating satisfactory staining results in their experimental setup.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


MALLIKARJUNA (Verified Customer) (11-26-2025)

GODD FOR IF

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1;100
  • Cell Tissue Type: liver tissue
Loading...
||
New chat

Able™

正在加载,请稍候...