CD8a Monoclonal antibody

CD8a Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66868-1-Ig

Clone No.1G2B10

Publications(330)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD8, 1G2B10, CD8a molecule, Leu2, MAL

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC-AutostainerIHCIF-P

WB analysis of MOLT-4 using 66868-1-Ig
MOLT-4 cells were subjected to SDS PAGE followed by western blot with 66868-1-Ig (CD8a antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human peripheral blood leukocyte using 66868-1-Ig
Human peripheral blood leukocyte cells were subjected to SDS PAGE followed by western blot with 66868-1-Ig (CD8a antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human spleen using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66868-1-Ig (CD8 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:4000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:4000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 66868-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66868-1-Ig (CD8a antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 66868-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD8a antibody (66868-1-Ig, Clone: 1G2B10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 66868-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD8a antibody (66868-1-Ig, Clone: 1G2B10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (330)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MOLT-4 cells, human peripheral blood leukocyte
Positive IHC detected in	human tonsillitis tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lung cancer tissue, human pancreas cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human tonsillitis tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunohistochemistry (IHC)	IHC : 1:10000-1:40000
Immunofluorescence (IF)-P	IF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66868-1-Ig targets CD8a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, pig, bovine
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species
Full Name	CD8a molecule
Calculated Molecular Weight	235 aa, 26 kDa
Observed Molecular Weight	32 kDa
GenBank Accession Number	BC025715
Gene Symbol	CD8A
Gene ID (NCBI)	925
ENSEMBL Gene ID	ENSG00000153563
RRID	AB_2882205
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P01732
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule.

Protocols

Product Specific Protocols
IF protocol for CD8a antibody 66868-1-Ig	Download protocol
IHC protocol for CD8a antibody 66868-1-Ig	Download protocol
WB protocol for CD8a antibody 66868-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IF	Signal Transduct Target Ther Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy Authors - Xiao Hu View Article
	IF	Cancer Cell Spatial determinants of antibody-drug conjugate SHR-A1811 efficacy in neoadjuvant treatment for HER2-positive breast cancer Authors - Ding Ma View Article
human		Cancer Cell Proteogenomic characterization of non-functional pancreatic neuroendocrine tumors unravels clinically relevant subgroups Authors - Shunrong Ji View Article
human	IHC	Mol Cancer ACOX2 destabilizes the MRE11-RAD50-NBS1 complex and boosts anticancer immunity via the cGAS-STING pathway in clear cell renal cell carcinoma. Authors - Shiqi Ye View Article
	IHC	Mol Cancer The construction of modular universal chimeric antigen receptor T (MU-CAR-T) cells by covalent linkage of allogeneic T cells and various antibody fragments Authors - Tao Chen View Article
human	IF	Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer Authors - Yu Jiang View Article