Tested Applications
| Positive IHC detected in | human colon tissue, human colon cancer tissue, human ovary tumor tissue, human pancreas cancer tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
80009-1-RR targets Collagen Type III (N-terminal) in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18658 Product name: Recombinant human COL3A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-152 aa of BC028178 Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS Predict reactive species |
| Full Name | collagen, type III, alpha 1 |
| Calculated Molecular Weight | 1466 aa, 139 kDa |
| GenBank Accession Number | BC028178 |
| Gene Symbol | COL3A1 |
| Gene ID (NCBI) | 1281 |
| RRID | AB_2882939 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02461 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type III (N-terminal) antibody 80009-1-RR | Download protocol |
| IHC protocol for Collagen Type III (N-terminal) antibody 80009-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Collagen Type III (N-terminal) Recombinant monoclonal antibody (2O1), catalog number 80009-1-RR, has 1 total citation. It appears in the journal Phytomedicine (2025). The associated research field is oral microbiology, specifically examining microbial signatures of areca nut chewing and their link to oral dysbiosis and submucous fibrosis, using Western blot.
| Species | Application | Title |
|---|---|---|
Phytomedicine Microbial signatures of areca nut chewing: Bridging the gap between oral dysbiosis and submucous fibrosis. |
Reviews
What customers say
The single review for this product is a 5-star rating from a user who tested it for immunohistochemistry and immunofluorescence on human kidney cortex. Using a 1:2000 dilution with citrate buffer antigen retrieval (pressure cooker) and a 1-hour room temperature incubation, the antibody performed well. The user noted that both 1:200 and 1:2000 dilutions gave similar IHC results with a VECTASTAIN Elite ABC-HRP detection kit, and it also worked effectively for immunofluorescence at 1:200. Overall, the reviewer reported reliable staining performance across both applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lucia (Verified Customer) (03-11-2025) | Antigen retrieval performed with citrate buffer in pressure cooker. Primary antibody 1h RT, tested 1:200 and 1:2000 and both gave similar results. Detection method Vector VECTASTAIN[R] Elite ABC-HRP Kit. Staining worked with immunofluorescence as well (1:200 1h RT).
|
