Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, SGC-7901 cells, HeLa cells, mouse skeletal muscle tissue |
| Positive IP detected in | mouse heart tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | human cervical cancer tissue, human normal colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14749-1-AP targets CORO1C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6488 Product name: Recombinant human CORO1C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC002342 Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN Predict reactive species |
| Full Name | coronin, actin binding protein, 1C |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 57 kDa |
| GenBank Accession Number | BC002342 |
| Gene Symbol | CORO1C |
| Gene ID (NCBI) | 23603 |
| RRID | AB_2230110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9ULV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CORO1C antibody 14749-1-AP | Download protocol |
| IHC protocol for CORO1C antibody 14749-1-AP | Download protocol |
| IP protocol for CORO1C antibody 14749-1-AP | Download protocol |
| WB protocol for CORO1C antibody 14749-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Coronin 1C (Cat# 14749-1-AP) has 19 citations. Journals include Cell, Autophagy, J Exp Clin Cancer Res, Dev Cell, J Cell Biol, Clin Kidney J, Mol Med Rep, Sci Rep, Oncol Rep, Mol Cell Biochem, Front Mol Biosci, Genes, Hum Mol Genet, Discov Oncol, FEBS Open Bio, and PLoS Biol. Research fields span endosomal/ER membrane biology, actin dynamics, autophagy, stress granules, and multiple cancers including hepatocellular, renal cell, breast, colorectal, gastric, pancreatic, prostate, and mesothelioma.
| Species | Application | Title |
|---|---|---|
Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules | ||
Cell A Novel Class of ER Membrane Proteins Regulates ER-Associated Endosome Fission.
| ||
Autophagy CORO1C (coronin 1C) promotes autophagosome formation by coordinating branched actin network dynamics
| ||
J Exp Clin Cancer Res Coronin-1C is a novel biomarker for hepatocellular carcinoma invasive progression identified by proteomics analysis and clinical validation. | ||
Dev Cell EPLINα controls integrin recycling from Rab21 endosomes to drive breast cancer cell migration. | ||
J Cell Biol Coronin 1C restricts endosomal branched actin to organize ER contact and endosome fission. |
Reviews
What customers say
The single review for this product is positive. A researcher rated it 4 out of 5 stars and reported that it worked well in Western blot at a 1:1000 dilution using mouse haematopoietic cells. The review was posted in December 2019 and references lot 00005772. Overall, the feedback suggests reliable performance for WB applications in mouse samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wen (Verified Customer) (12-22-2019) | Work well in western blot
|
