Featured Product
KD/KO Validated

COXIV Polyclonal antibody

The COXIV polyclonal antibody (11242-1-AP) is one of the most highly cited COXIV antibodies in the market. It is suitable for WB, IHC, IF/ICC, IP, ELISA and has been referenced in over 661 publications.

Cat No. 11242-1-AP

Publications (661)

Reviews (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA
For FC, select conjugated version.

Synonyms

COX4I1, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite® Plus 647 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Validation Data Gallery
Proteintech vs. Other Vendors

Filter: AllWBIPIHCIF/ICC

WB analysis using 11242-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11242-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 11242-1-AP
WB result of COXIV antibody (11242-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COXIV transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11242-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat brain using 11242-1-AP
rat brain tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat liver using 11242-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 11242-1-AP (COXIV antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse skeletal muscle using 11242-1-AP
IP result of anti-COXIV (IP:11242-1-AP, 3ug; Detection:11242-1-AP 1:1000) with mouse skeletal muscle tissue lysate 3500ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 11242-1-AP (COXIV antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 11242-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11242-1-AP (COXIV antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 11242-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COXIV antibody (11242-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

"COXIV Antibodies" Comparison

View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.

Able AI

What's the best dilution for COXIV in ?

Overview

Tested Applications
Product Information
Publications (661)
Protocols
Reviews (7)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, HEK-293 cells, HepG2 cells, rat brain tissue, rat liver tissue, mouse heart tissue, mouse liver tissue, mouse lung tissue, Jurkat cells, NIH/3T3 cells, mouse skeletal muscle tissue, MCF-7 cells
Positive IP detected in	mouse skeletal muscle tissue
Positive IHC detected in	human prostate cancer tissue, human pancreas cancer tissue, human heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:20000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11242-1-AP targets COXIV in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig, canine, bovine, goat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species
Full Name	cytochrome c oxidase subunit IV isoform 1
Calculated Molecular Weight	19.6 kDa
Observed Molecular Weight	17-18 kDa
GenBank Accession Number	BC021236
Gene Symbol	COX IV
Gene ID (NCBI)	1327
RRID	AB_2085278
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P13073
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.

Protocols

Product Specific Protocols
IF protocol for COXIV antibody 11242-1-AP	Download protocol
IHC protocol for COXIV antibody 11242-1-AP	Download protocol
IP protocol for COXIV antibody 11242-1-AP	Download protocol
WB protocol for COXIV antibody 11242-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COXIV Polyclonal antibody (Cat# 11242-1-AP) has accumulated 661 citations across numerous high-impact journals, including Nature, Science, Cell Metabolism, Cell Research, Immunity, Nature Metabolism, Nature Cell Biology, Nature Communications, Cancer Research, Autophagy, Molecular Cell, Cell Death & Differentiation, and Theranostics. Research fields span mitochondrial biology, cancer metabolism, mitophagy, neurodegeneration, cardiovascular disease, oxidative stress, diabetes, and immunology, with applications primarily in Western blot and immunofluorescence.

Species	Application	Title
human	WB	Signal Transduct Target Ther Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma. Authors - Panpan Zhang View Article
human	IF	Nature Lysosomes drive the piecemeal removal of mitochondrial inner membrane Authors - Akriti Prashar View Article
	WB	Science Boosting neuronal activity-driven mitochondrial DNA transcription improves cognition in aged mice Authors - Wenwen Li View Article
mouse	WB	Circulation Nuclear Receptor NR1D1 Regulates Abdominal Aortic Aneurysm Development by Targeting the Mitochondrial Tricarboxylic Acid Cycle Enzyme Aconitase-2 Authors - Ling-Yue Sun View Article
human	IF	Cell Metab Pyruvate metabolism enzyme DLAT promotes tumorigenesis by suppressing leucine catabolism Authors - Ning Wang View Article
human	WB	Cell Metab Derepressing nuclear pyruvate dehydrogenase induces therapeutic cancer cell reprogramming Authors - Ting Zhao View Article

Reviews

4.7 out of 5

Add a review

7 verified customer reviews

What customers say

Users report consistently positive results, with an average rating of 4.7 out of 5 across seven reviews. The antibody is primarily used for Western Blot, with one Immunofluorescence application. Reviewers highlight strong signal intensity, good specificity, and clear bands at dilutions of 1:500 to 1:1000. It has been validated in mouse heart tissue, human fibroblasts, HEK293 cells, primary human cell fractions, and isolated sperm. One reviewer noted a slightly diffuse band at the expected molecular weight, but overall the antibody is described as reliable and effective for detecting mitochondrial COXIV.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Xinyi (Verified Customer) (08-28-2026)	We use COXIV rabbit polyAB to detect mitochondria amount in our mouse heart tissues and it works perfectly. Applications: Western Blot Cell Tissue Type: Mouse heart mitochondria .
Matthieu (Verified Customer) (09-24-2025)	Slightly diffuse band at the expected size Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: human fibroblasts
Vignesh (Verified Customer) (09-03-2025)	Good product with good specificity. Applications: Western Blot Primary Antibody Dilution: 1:500 Cell Tissue Type: HEK293 cells
Jimmy (Verified Customer) (02-27-2024)	Strong signal in primary human cell fractions. Applications: Western Blot
Maria (Verified Customer) (08-17-2021)	Good ab, works well 1:1000 in BSA 3% O/N 4ºC incubation. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: human primary fibroblasts COXIV Antibody Western Blot validation (1:1000 dilution) in human primary fibroblasts (Cat no:11242-1-AP)
Mohammed (Verified Customer) (08-19-2020)	Very strong staining in the midpiece of the sperm tail. Applications: Immunofluorescence Primary Antibody Dilution: (1:200) Cell Tissue Type: Isolated sperm
SITING (Verified Customer) (07-13-2020)	THIS IS A GOOD ANTIBODY, CAN SEE CLEAR BAND Applications: Western Blot, COXIV Antibody Western Blot, validation ( dilution) in (Cat no:11242-1-AP)