Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HT-29 cells, MCF-7 cells, mouse embryo tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human skin cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10225-1-AP targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Predict reactive species |
| Full Name | cellular retinoic acid binding protein 2 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC001109 |
| Gene Symbol | CRABP2 |
| Gene ID (NCBI) | 1382 |
| RRID | AB_2085455 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29373 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| IF protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| IHC protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| IP protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| WB protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CRABP2 antibody (Cat# 10225-1-AP) has 60 total citations published in journals including Science, Nature Communications, Neuron, Molecular Cell, PNAS, Journal of Experimental & Clinical Cancer Research, Cell Death & Disease, Development, and Oncotarget. Research fields span cancer biology (breast, lung, ovarian, gastric, colorectal, melanoma, glioblastoma), retinoic acid signaling, developmental biology, neuroscience, meningeal biology, fibrosis, and drug resistance mechanisms.
| Species | Application | Title |
|---|---|---|
Science C1q and immunoglobulins mediate activity-dependent synapse loss in the adult brain. | ||
Science A single progenitor population switches behavior to maintain and repair esophageal epithelium. | ||
Nat Commun The chromatin regulator Ankrd11 controls cardiac neural crest cell-mediated outflow tract remodeling and heart function | ||
Nat Commun Heterogeneous fibroblasts contribute to fibrotic scar formation after spinal cord injury in mice and monkeys | ||
Neuron Divergent Hox Coding and Evasion of Retinoid Signaling Specifies Motor Neurons Innervating Digit Muscles. |
Reviews
What customers say
All three reviewers gave this antibody a perfect 5-star rating. Users report excellent performance in both immunofluorescence and Western blot applications. One user successfully used it at 1:200 dilution on mouse embryonic sections for IF, while another confirmed it works well in KO versus WT control mice on mouse brain tissue by WB. Overall, customers describe it as a very good antibody with reliable results across different applications and tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yan (Verified Customer) (01-27-2020) | I used this antibody on mouse embryonic section for the immunofluorescence. It worked very well.
|
lunfeng (Verified Customer) (01-27-2020) | VERY GOOD
|
Jie (Verified Customer) (01-27-2020) | VERY GOOD ANTIBODY. WORKS IN KO VERSUS WT CONTROL MICE.
|
