Tested Applications
| Positive WB detected in | TNF alpha, PMA and BSA treated A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85606-5-RR targets CXCL5 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2939 Product name: Recombinant Human CXCL5 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 37-114 aa of NM_002994.4 Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 5 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | NM_002994.4 |
| Gene Symbol | CXCL5 |
| Gene ID (NCBI) | 6374 |
| RRID | AB_3744234 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P42830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CXCL5 antibody 85606-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CXCL5 Recombinant monoclonal antibody (242885D10), catalog number 85606-5-RR, has a total of 1 citation. It appears in Ecotoxicology and Environmental Safety (2025), used in Western Blot for human samples. The cited study investigates cadmium exposure's role in upregulating TXNIP and aggravating calcium oxalate kidney stone formation through cell-crystal adhesion, apoptosis, and macrophage M1 polarization—placing the research in the fields of environmental toxicology, nephrology, and innate immunity.
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf Cadmium exposure upregulates TXNIP and aggravates calcium oxalate kidney stone formation by promoting cell-crystal adhesion, apoptosis and macrophage M1 polarization.
|
