CXCL5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 85606-5-RR (same clone as 85606-5-PBS)

  TNF alpha, PMA and BSA treated A549 cells were subjected to SDS PAGE followed by western blot with 85606-5-RR (CXCL5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85606-5-PBS in a different storage buffer formulation.

CXCL5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85606-5-PBS

Clone No.242885D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C X C motif chemokine 5, C-X-C motif chemokine 5, CXCL 5, CXCL-5, ENA-78(1-78)

---

Product Information

85606-5-PBS targets CXCL5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2939

  Product name: Recombinant Human CXCL5 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 37-114 aa of NM_002994.4

  Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

• Full Name: chemokine (C-X-C motif) ligand 5
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: NM_002994.4
• Gene Symbol: CXCL5
• Gene ID (NCBI): 6374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.