• Featured Product
  • KD/KO Validated

Calnexin Monoclonal antibody

Calnexin Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66903-1-Ig
Clone No.2A2C6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, ELISA

CANX, 2A2C6, CNX, IP90, Major histocompatibility complex class I antigen-binding protein p88

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman hepatocirrhosis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66903-1-Ig targets Calnexin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25535

Product name: Recombinant human Calnexin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-273 aa of BC003552

Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS

Predict reactive species
Full Name calnexin
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC003552
Gene Symbol Calnexin
Gene ID (NCBI) 821
RRIDAB_2882231
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP27824
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker.

Protocols

Product Specific Protocols
IF protocol for Calnexin antibody 66903-1-IgDownload protocol
IHC protocol for Calnexin antibody 66903-1-IgDownload protocol
WB protocol for Calnexin antibody 66903-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Res

Targeting ATAD3A-PINK1-mitophagy axis overcomes chemoimmunotherapy resistance by redirecting PD-L1 to mitochondria

Authors - Xiao-Qing Xie
mouse,humanWB,IF

Nat Commun

ERK and USP5 govern PD-1 homeostasis via deubiquitination to modulate tumor immunotherapy

Authors - Xiangling Xiao
humanWB

Mol Cell

The HRI branch of the integrated stress response selectively triggers mitophagy

Authors - Yogaditya Chakrabarty
mouseIF

Acta Pharm Sin B

The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway.

Authors - Weimin Yu
ratWB

J Control Release

Extracellular vesicles encapsulated with caspase-1 inhibitor ameliorate experimental autoimmune myasthenia gravis through targeting macrophages

Authors - Yang Zhou
mouseIF

Clin Transl Med

Targeting KDM4 family epigenetically triggers antitumour immunity via enhancing tumour-intrinsic innate sensing and immunogenicity

Authors - Mayu Sun

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Samantha (Verified Customer) (03-18-2024)

Tested on HeLA cells and produced clean bands that were cut out and analysed with Mass Spectrometry

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/10,000
  • Cell Tissue Type: HeLa Cells
FH

Amy (Verified Customer) (11-08-2023)

Clean antibody with strong band for WB in HEK293T lysates.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10,000
  • Cell Tissue Type: HEK293T
Loading...
||
New chat Able
正在加载,请稍候...