Tested Applications
| Positive WB detected in | mouse serum, rat serum, rat plasma, human plasma |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84101-5-RR targets Complement factor B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0226 Product name: Recombinant human CFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 574-762 aa of BC007990 Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG Predict reactive species |
| Full Name | complement factor B |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 93-100 kDa |
| GenBank Accession Number | BC007990 |
| Gene Symbol | Complement factor B |
| Gene ID (NCBI) | 629 |
| RRID | AB_3671666 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P00751 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease that is associated with C3b and forms the alternative pathway for C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Complement factor B antibody 84101-5-RR | Download protocol |
| IHC protocol for Complement factor B antibody 84101-5-RR | Download protocol |
| WB protocol for Complement factor B antibody 84101-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Complement factor B Recombinant monoclonal antibody (241141A8), catalog number 84101-5-RR, has 2 total citations. One appears in PLoS Pathogens (2026), studying C/EBP-β-regulated complement hyperactivation in SFTSV-infected mice using IHC. The other is in Laboratory Investigation (2024), examining complement component 3's role in olfactory receptor neuron regeneration. The associated research fields span immunology/complement biology and neuroscience.
| Species | Application | Title |
|---|---|---|
PLoS Pathog C/EBP-β-regulated complement hyperactivation in spleen of SFTSV-infected mice: A clue to targeted complement therapy. | ||
Reviews
What customers say
The single review reports successful immunohistochemistry staining of mouse colitic colon tissue (areas of erosion and crypts) using this Complement Factor B rabbit recombinant antibody at a 1:400 dilution on paraffin-embedded sections. Heat-mediated antigen retrieval with Tris-EDTA (pH 8.5) was applied, and results were imaged at 40x. The reviewer rated the product 5 out of 5, indicating strong performance and satisfaction with the staining outcome.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Benedicte (Verified Customer) (06-05-2026) | IHC staining of mouse colitic colon (aera of erosion and crypts) using 84101-5-RR. Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84101-5-RR (Complement factor B Rabbit RecAb) at dilution of 1:400 (40x on NDPview). Heat mediated antigen retrieval with Tris EDTA (pH 8.5)
 |
