Complement factor B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84101-5-RR (same clone as 84101-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84101-5-RR (Complement factor B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84101-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84101-5-RR (same clone as 84101-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84101-5-RR (Complement factor B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84101-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84101-5-RR (same clone as 84101-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84101-5-RR (Complement factor B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84101-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 84101-5-RR (same clone as 84101-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Complement factor B antibody (84101-5-RR, Clone: 241141A8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 84101-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84101-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84101-5-RR against Human Complement factor B were performed. The affinity constant is 2.27 nM.

Complement factor B Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84101-5-PBS

Clone No.241141A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CFB, CFAB, C3/C5 convertase, BFD, BF

---

Product Information

84101-5-PBS targets Complement factor B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0226

  Product name: Recombinant human CFB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 574-762 aa of BC007990

  Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG

• Full Name: complement factor B
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 93-100 kDa
• GenBank Accession Number: BC007990
• Gene Symbol: Complement factor B
• Gene ID (NCBI): 629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P00751
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease that is associated with C3b and forms the alternative pathway for C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.