DDX18 Recombinant monoclonal antibody

DDX18 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85789-3-RR
Clone No.250053E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

ATP-dependent RNA helicase DDX18, cPERP-D, DEAD box protein 18, EC:3.6.4.13, MrDb

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, HeLa cells, K-562 cells, Jurkat cells, MCF-7 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85789-3-RR targets DDX18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27457

Product name: Recombinant human DDX18 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-165 aa of BC001238

Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
Calculated Molecular Weight 75 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC001238
Gene Symbol DDX18
Gene ID (NCBI) 8886
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NVP1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency.

Protocols

Product Specific Protocols
IF protocol for DDX18 antibody 85789-3-RRDownload protocol
IHC protocol for DDX18 antibody 85789-3-RRDownload protocol
WB protocol for DDX18 antibody 85789-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...