CoraLite® Plus 488-conjugated DDX18 Recombinant monoclonal antibody

DDX18 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85789-3
Clone No.250053E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

ATP-dependent RNA helicase DDX18, cPERP-D, DEAD box protein 18, EC:3.6.4.13, MrDb

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85789-3 targets DDX18 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27457

Product name: Recombinant human DDX18 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 7-165 aa of BC001238

Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
Calculated Molecular Weight 75 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC001238
Gene Symbol DDX18
Gene ID (NCBI) 8886
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NVP1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DDX18 antibody CL488-85789-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...