• Featured Product
  • KD/KO Validated

EPCAM/CD326 Monoclonal antibody

EPCAM/CD326 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 66316-1-Ig
Clone No.2A2D5

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

EPCAM, 2A2D5, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHaCaT cells, A431 cells, T-47D cells, MCF-7 cells
Positive IHC detected inHuman colon tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue, human stomach cancer tissue
Positive IF/ICC detected inMCF-7 cells, HT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66316-1-Ig targets EPCAM/CD326 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15393

Product name: Recombinant human EPCAM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-264 aa of BC014785

Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGL

Predict reactive species
Full Name epithelial cell adhesion molecule
Calculated Molecular Weight 314 aa, 35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC014785
Gene Symbol EPCAM
Gene ID (NCBI) 4072
RRIDAB_2881697
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16422
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)

Protocols

Product Specific Protocols
IF protocol for EPCAM/CD326 antibody 66316-1-IgDownload protocol
IHC protocol for EPCAM/CD326 antibody 66316-1-IgDownload protocol
WB protocol for EPCAM/CD326 antibody 66316-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Acta Biomater

Tumor cell membrane-based peptide delivery system targeting the tumor microenvironment for cancer immunotherapy and diagnosis.

Authors - Xiangzhou Meng
human

Biosens Bioelectron

Spherical nucleic acids-based cascade signal amplification for highly sensitive detection of exosomes.

Authors - Lei Wang
humanWB

Mol Ther Nucleic Acids

miR-552 Regulates Liver Tumor-Initiating Cell Expansion and Sorafenib Resistance.

Authors - Tao Han
humanWB

Talanta

Multi-modal imaging probe for EpCAM overexpressed in breast cancer.

Authors - Yaxue Dai
  • KD Validated
humanWB

Cell Death Dis

Mutations in the coat complex II component SEC23B promote colorectal cancer metastasis.

Authors - Chunyuan Yang
WB

Cell Death Discov

MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling

Authors - Xin Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Guorong (Verified Customer) (03-31-2022)

Seems not good for ARPE-19 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: ARPE-19
EPCAM/CD326 Antibody Western Blot validation (1:2000 dilution) in ARPE-19 (Cat no:66316-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...