Use Able AI chat for product recommendations

Piezo1 (extracellular domain) Recombinant monoclonal antibody

Piezo1 (extracellular domain) Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 82625-4-RR
Clone No.4B15

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

FAM38A, PIEZO1, KIAA0233, Membrane protein induced by beta-amyloid treatment, Piezo-type mechanosensitive ion channel component 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, SGC-7901 cells, hTERT-RPE1 cells
Positive IHC detected inrat dorsal root ganglion tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82625-4-RR targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7791

Product name: Recombinant human FAM38A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-373 aa of BC008073

Sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKHHGAVRVHRAGHRQVRARILQRDLALHYVRGAAVRGPHPQALPGHLPGAGDSGAGAGGGVVCQAHLPLPLTGDHDQVDS

Predict reactive species
Full Name family with sequence similarity 38, member A
Calculated Molecular Weight 286 kDa
Observed Molecular Weight 233-286 kDa
GenBank Accession NumberBC008073
Gene Symbol Piezo1/FAM38A
Gene ID (NCBI) 9780
RRIDAB_3670524
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92508
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells that influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as Piezo1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Piezo1 also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in the gene encoding Piezo1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. (PMID: 20016066, 28416610)

Protocols

Product Specific Protocols
IF protocol for Piezo1 (extracellular domain) antibody 82625-4-RRDownload protocol
IHC protocol for Piezo1 (extracellular domain) antibody 82625-4-RRDownload protocol
WB protocol for Piezo1 (extracellular domain) antibody 82625-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIHC

Commun Biol

Piezo1 promotes the progression of necrotizing enterocolitis by activating the Ca2(+)/CaMKII-dependent pathway

Authors - Zhenyu Li
ratWB

Adv Sci (Weinh)

Ultrasound-Activated Bifunctional Piezoelectric Hydrogel Dressings Promote Infected Wound Healing via Regulating Angiogenesis and Lymphangiogenesis.

Authors - Xiang Li

Acta Biomater

Mechanically heterogeneous nanofibrous hydrogel drives Piezo1-mediated cell aggregation and collective migration.

Authors - Haiyuan Song
human, ratWB,IF

Biochem Biophys Res Commun

Activation of PIEZO1 impairs tissue expansion by inducing fibroblast apoptosis.

Authors - Yaotao Guo

Acta Biomater

Mechanically Adaptive Hydrogels Reprogram Apoptotic Cell Clearance to Prevent Tissue Fibrosis.

Authors - Lina Huang
humanIF

Nat Commun

PIEZO1 drives trophoblast fusion and placental development

Authors - Yang Zhang
Loading...
||
New chat

Able

正在加载,请稍候...