CoraLite® Plus 488-conjugated Piezo1 (extracellular domain) Recombinant monoclonal antibody

Piezo1 (extracellular domain) Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82625-4
Clone No.4B15

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

FAM38A, PIEZO1, 4B15, KIAA0233, Membrane protein induced by beta-amyloid treatment

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82625-4 targets Piezo1 (extracellular domain) in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7791

Product name: Recombinant human FAM38A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-373 aa of BC008073

Sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKHHGAVRVHRAGHRQVRARILQRDLALHYVRGAAVRGPHPQALPGHLPGAGDSGAGAGGGVVCQAHLPLPLTGDHDQVDS

Predict reactive species
Full Name family with sequence similarity 38, member A
Calculated Molecular Weight 286 kDa
Observed Molecular Weight 233-286 kDa
GenBank Accession NumberBC008073
Gene Symbol Piezo1/FAM38A
Gene ID (NCBI) 9780
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92508
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells that influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as Piezo1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Piezo1 also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in the gene encoding Piezo1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. (PMID: 20016066, 28416610)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Piezo1 (extracellular domain) antibody CL488-82625-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...