Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GP73/GOLPH2 Polyclonal antibody

GP73/GOLPH2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

GOLM1, GOLPH2, GP73, C9orf155, Golgi membrane protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GP73/GOLPH2 in ?

Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HuH-7 cells, MDA-MB-231 cells, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman stomach cancer tissue, human liver cancer tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15126-1-AP targets GP73/GOLPH2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7207

Product name: Recombinant human GOLM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 36-400 aa of BC001740

Sequence: SRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Predict reactive species
Full Name golgi membrane protein 1
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC001740
Gene Symbol GP73
Gene ID (NCBI) 51280
RRIDAB_2113330
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NBJ4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi phosphoprotein 2 (GOLPH2, also known as GP73 or GOLM1) is a resident Golgi type-II membrane protein. It is predominantly expressed in the epithelial cells of many human tissues. GOLPH2 traffics through endosomes and can be secreted into the circulation. Its expression is upregulated in a number of tumors and GOLPH2 could be a promising serum marker for hepatocellular carcinoma. We got 70-75 kDa in western blotting due to phosphorylation.

Protocols

Product Specific Protocols
IF protocol for GP73/GOLPH2 antibody 15126-1-APDownload protocol
IHC protocol for GP73/GOLPH2 antibody 15126-1-APDownload protocol
IP protocol for GP73/GOLPH2 antibody 15126-1-APDownload protocol
WB protocol for GP73/GOLPH2 antibody 15126-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-GP73 (catalog no. 15126-1-AP) has accumulated 23 citations across journals including Molecular Cancer, Molecular Cell, Developmental Cell, Journal of Immunotherapy of Cancer, PLoS Pathogens, Clinical and Molecular Hepatology, Journal of Advanced Research, Cell Signaling, Journal of Cellular Science, International Journal of Cardiology, Diagnostic Pathology, Journal of Cancer, Pediatric Research, and Current Alzheimer's Research. Research fields span hepatocellular carcinoma, colorectal cancer, ferroptosis, viral hepatitis, cardiovascular disease, glioma, epilepsy, and Alzheimer's disease.

SpeciesApplicationTitle
mouseWB

Signal Transduct Target Ther

GOLM1 restricts colitis and colon tumorigenesis by ensuring Notch signaling equilibrium in intestinal homeostasis.

Authors - Yang Pu
mouse,humanWB,IF

Mol Cancer

GP73-dependent regulation of exosome biogenesis promotes colorectal cancer liver metastasis

Authors - Linfei Huang
mouse,humanWB,IHC,IF

Clin Mol Hepatol

GOLM1 promotes cholesterol gallstone formation via ABCG5-mediated cholesterol efflux in MASH livers

Authors - Yi-Tong Li
  • KD Validated
humanWB

J Extracell Vesicles

A Unique Intercellular Feedforward Loop From HK1 to TGF-β1 Promotes the Progression of Hepatocellular Carcinoma.

Authors - Qi-tao Chen
mouse,humanIF

J Adv Res

The GOLM1-ACLY pathway regulates macrophage-secreted EFEMP1 via H3K27ac modifications to drive tumor progression

Authors - Lan Zhen

Mol Cell

LZTFL1 rewires NADPH-glutathione metabolism to amplify ferroptosis.

Authors - Xiangfei Xue
Loading...
||
New chat

Able™

正在加载,请稍候...