Use Able AI chat for product recommendations

TIM3 Monoclonal antibody

TIM3 Monoclonal Antibody for WB, ELISA

Cat No. 60355-1-Ig
Clone No. 4C4G3
Publications (31)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF, ELISA

4C4G3, CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TIM3 in ?

Tested Applications

Positive WB detected inDaudi cells, PC-3 cells, pig thymus tissue, ROS1728 cells, human heart tissue, RAW 264.7 cells, rat heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60355-1-Ig targets TIM3 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16901

Product name: Recombinant human HAVCR2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-142 aa of BC020843

Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE

Predict reactive species
Full Name hepatitis A virus cellular receptor 2
Calculated Molecular Weight 301 aa, 33 kDa
Observed Molecular Weight 33 kDa, 50-70 kDa
GenBank Accession NumberBC020843
Gene Symbol TIM3
Gene ID (NCBI) 84868
RRIDAB_2881464
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8TDQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301).

Protocols

Product Specific Protocols
WB protocol for TIM3 antibody 60355-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-TIM-3 (Cat# 60355-1-Ig) has 31 citations across journals including Cancer Cell, Nature Communications, Advanced Science, Oncogene, Cell Death & Disease, Frontiers in Immunology, EBioMedicine, Small, and iScience. Research fields span cancer immunology (glioblastoma, breast cancer, gastric cancer, melanoma, prostate cancer, DLBCL), immune checkpoint biology, diabetic nephropathy, pregnancy immunology, autoimmune diseases (dermatomyositis, ankylosing spondylitis), and tissue repair.

SpeciesApplicationTitle
humanIF

Cancer Cell

TIM3+ breast cancer cells license immune evasion during micrometastasis outbreak

Authors - Catalina Rozalén
mouse

Nat Commun

Redox-responsive polymer micelles co-encapsulating immune checkpoint inhibitors and chemotherapeutic agents for glioblastoma therapy

Authors - Zhiqi Zhang
humanIF

Adv Sci (Weinh)

Dysfunctional Decidual CD4+T Cells Induce Recurrent Pregnancy Loss via Palmitoylation-Dependent Tim-3 Lysosomal Sorting and Degradation

Authors - Liyuan Cui
humanWB

Cell Death Dis

Helicobacter pylori CagA promotes gastric cancer immune escape by upregulating SQLE

Authors - Sifan Liu
IF

Small

Engineered Exosome-Loaded Silk Fibroin Composite Hydrogels Promote Tissue Repair in Spinal Cord Injury Via Immune Checkpoint Blockade

Authors - Xiaoyu Dong
human

EBioMedicine

Immunological profiles of human oligodendrogliomas define two distinct molecular subtypes

Authors - Fan Wu

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product (lot 10002413) was posted in April 2019 by a user named Santhosh, who rated it 4 out of 5 stars. The reviewer used the antibody at a 1:200 dilution for immunohistochemistry on human tonsil FFPE tissue, employing heat-mediated antigen retrieval at pH 6. Overall, the feedback suggests satisfactory performance in IHC applications on human tissue.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Santhosh (Verified Customer) (04-15-2019)

Human Tonsil FFPE tissue. Heat mediated antigen retrieval (pH 6)

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:200
TIM3 Antibody Immunohistochemistry, validation (1:200 dilution) in (Cat no:60355-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...