IFIT1 Recombinant monoclonal antibody

IFIT1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83423-1-RR
Clone No.240132G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

240132G11, G10P1, IFI 56K, IFI56, IFI-56K

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIFN alpha treated HeLa cells, SGC-7901 cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83423-1-RR targets IFIT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19691

Product name: Recombinant human IFIT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 340-460 aa of BC007091

Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY

Predict reactive species
Full Name interferon-induced protein with tetratricopeptide repeats 1
Calculated Molecular Weight 478 aa, 55 kDa
Observed Molecular Weight 55-65 kDa
GenBank Accession NumberBC007091
Gene Symbol IFIT1
Gene ID (NCBI) 3434
RRIDAB_3671072
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP09914
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication.

Protocols

Product Specific Protocols
FC protocol for IFIT1 antibody 83423-1-RRDownload protocol
IHC protocol for IFIT1 antibody 83423-1-RRDownload protocol
WB protocol for IFIT1 antibody 83423-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...