IFITM3 Recombinant monoclonal antibody

IFITM3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 81135-3-RR
Clone No.242056C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

1 8U, 242056C9, DSPA2b, IFITM2/3, Interferon-induced transmembrane protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, THP-1 cells
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81135-3-RR targets IFITM3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2285

Product name: Recombinant human IFITM3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-133 aa of BC006794

Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Predict reactive species
Full Name interferon induced transmembrane protein 3 (1-8U)
Calculated Molecular Weight 133 aa, 15 kDa
Observed Molecular Weight15-20 kDa
GenBank Accession NumberBC006794
Gene Symbol IFITM3
Gene ID (NCBI) 10410
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01628
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression.

Protocols

Product Specific Protocols
FC protocol for IFITM3 antibody 81135-3-RRDownload protocol
IF protocol for IFITM3 antibody 81135-3-RRDownload protocol
WB protocol for IFITM3 antibody 81135-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...