Tested Applications
| Positive WB detected in | HEK-293 cells, BxPC-3 cells, HeLa cells, HepG2 cells, mouse brain tissue, mouse placenta tissue, NIH/3T3 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14642-1-AP targets IGF2BP3 in WB, IHC, IF, IP, CoIP, RIP, IP-MS, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6226 Product name: Recombinant human IGF2BP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-579 aa of BC065269 Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK Predict reactive species |
| Full Name | insulin-like growth factor 2 mRNA binding protein 3 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 64 kDa |
| GenBank Accession Number | BC065269 |
| Gene Symbol | IGF2BP3 |
| Gene ID (NCBI) | 10643 |
| RRID | AB_2122782 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00425 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IGF2BP3 antibody 14642-1-AP | Download protocol |
| IP protocol for IGF2BP3 antibody 14642-1-AP | Download protocol |
| WB protocol for IGF2BP3 antibody 14642-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-IGF2BP3 antibody (Cat# 14642-1-AP) has accumulated 220 citations published in top journals including Cell, Nature Communications, Cancer Cell, Molecular Cancer, Cell Reports, Oncogene, Developmental Cell, and Science Advances. Key research fields include m6A RNA modification and epitranscriptomics, oncology spanning hepatocellular, colorectal, breast, gastric, pancreatic, ovarian, and lung cancers, inflammation and immunology, metabolic reprogramming, neurodegeneration, and fibrosis. Common applications are WB, RIP, IHC, IF, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Cancer Cell Lin28b is sufficient to drive liver cancer and necessary for its maintenance in murine models.
| ||
Cell Synonymous mutations promote tumorigenesis by disrupting m6A-dependent mRNA metabolism | ||
Mol Cancer METTL3-mediated m(6)A modification of CACNA1E promotes osteosarcoma progression and chemoresistance by enhancing WNT7B-mediated Ca(2+) signaling. | ||
Mol Cancer Demethylase ALKBH5 suppresses invasion of gastric cancer via PKMYT1 m6A modification. | ||
Cell Res Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells. |
Reviews
What customers say
User reviews are mixed. A 5-star reviewer reported it worked well for Western Blot on fibroblasts at 1:2000 dilution. A 4-star reviewer used it successfully for immunofluorescence at 1:50, noting nuclear localization. However, a 1-star reviewer found the antibody non-specific for Western Blot on neuroblastoma cells at 1:1500, reporting cross-reactivity with exogenous IGF2BP1-GFP and a double band around 70 kDa likely representing both IGF2BP1 and IGF2BP3. Overall, results vary by application and sample type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yevheniia (Verified Customer) (01-31-2025) | worked well
|
honglei (Verified Customer) (01-17-2023) | This antibody can be used for immunofluorescence and mainly localizes in the nucleus
|
Jessica (Verified Customer) (10-29-2018) | Also binds exogenous expressed IGF2BP1-GFP protein. I also get a double band around 70 kDa that is likely IGF2BP1 and IGF2BP3. This antibody is not specific.
|























