Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IGF2BP3 Polyclonal antibody

IGF2BP3 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, CoIP, RIP, IP-MS, ELISA

IGF2 mRNA-binding protein 3, IGF2BP 3, IGF-II mRNA-binding protein 3, IMP 3, IMP3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IGF2BP3 in ?

Tested Applications

Positive WB detected inHEK-293 cells, BxPC-3 cells, HeLa cells, HepG2 cells, mouse brain tissue, mouse placenta tissue, NIH/3T3 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14642-1-AP targets IGF2BP3 in WB, IHC, IF, IP, CoIP, RIP, IP-MS, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6226

Product name: Recombinant human IGF2BP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 240-579 aa of BC065269

Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 3
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC065269
Gene Symbol IGF2BP3
Gene ID (NCBI) 10643
RRIDAB_2122782
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00425
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.

Protocols

Product Specific Protocols
IHC protocol for IGF2BP3 antibody 14642-1-APDownload protocol
IP protocol for IGF2BP3 antibody 14642-1-APDownload protocol
WB protocol for IGF2BP3 antibody 14642-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-IGF2BP3 antibody (Cat# 14642-1-AP) has accumulated 220 citations published in top journals including Cell, Nature Communications, Cancer Cell, Molecular Cancer, Cell Reports, Oncogene, Developmental Cell, and Science Advances. Key research fields include m6A RNA modification and epitranscriptomics, oncology spanning hepatocellular, colorectal, breast, gastric, pancreatic, ovarian, and lung cancers, inflammation and immunology, metabolic reprogramming, neurodegeneration, and fibrosis. Common applications are WB, RIP, IHC, IF, IP, and CoIP.

SpeciesApplicationTitle
mouseWB

Cancer Cell

Lin28b is sufficient to drive liver cancer and necessary for its maintenance in murine models.

Authors - Liem H Nguyen
  • KD Validated
RIP

Cell

Synonymous mutations promote tumorigenesis by disrupting m6A-dependent mRNA metabolism

Authors - Yiheng Lan
humanWB

Cell

SIRT6 Suppresses Pancreatic Cancer through Control of Lin28b.

Authors - Sita Kugel
humanCoIP

Mol Cancer

METTL3-mediated m(6)A modification of CACNA1E promotes osteosarcoma progression and chemoresistance by enhancing WNT7B-mediated Ca(2+) signaling.

Authors - Chaotao Chen
humanWB,RIP

Mol Cancer

Demethylase ALKBH5 suppresses invasion of gastric cancer via PKMYT1 m6A modification.

Authors - Yiyang Hu
humanWB

Cell Res

Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells.

Authors - Fei Peng

Reviews

    3.3 out of 5
Add a review

3 verified customer reviews

What customers say

User reviews are mixed. A 5-star reviewer reported it worked well for Western Blot on fibroblasts at 1:2000 dilution. A 4-star reviewer used it successfully for immunofluorescence at 1:50, noting nuclear localization. However, a 1-star reviewer found the antibody non-specific for Western Blot on neuroblastoma cells at 1:1500, reporting cross-reactivity with exogenous IGF2BP1-GFP and a double band around 70 kDa likely representing both IGF2BP1 and IGF2BP3. Overall, results vary by application and sample type.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Yevheniia (Verified Customer) (01-31-2025)

worked well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: fibroblasts

honglei (Verified Customer) (01-17-2023)

This antibody can be used for immunofluorescence and mainly localizes in the nucleus

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: cell line

Jessica (Verified Customer) (10-29-2018)

Also binds exogenous expressed IGF2BP1-GFP protein. I also get a double band around 70 kDa that is likely IGF2BP1 and IGF2BP3. This antibody is not specific.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1500
  • Cell Tissue Type: Neuroblastoma cells (human)
Loading...
||
New chat

Able™

正在加载,请稍候...