IL-17RB Recombinant monoclonal antibody

IL-17RB Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85961-1-RR
Clone No.242967E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Evi27, IL-17 receptor B, IL-17 receptor homolog 1, IL-17B receptor, Il17br

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells, Transfected HEK-293T cells, mouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85961-1-RR targets IL-17RB in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2798

Product name: recombinant mouse Il17rb protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 18-286 aa of NM_019583.3

Sequence: REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG

Predict reactive species
Full Name interleukin 17 receptor B
Calculated Molecular Weight56 kDa
Observed Molecular Weight67 kDa
GenBank Accession NumberNM_019583.3
Gene Symbol Il17rb
Gene ID (NCBI) 50905
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9JIP3-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-17RB is a transmembrane protein that belongs to the IL-17 receptor family. IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17RB is expressed in various endocrine tissues and epithelial cells in different organs such as kidney, liver, and mucosal tissues. The IL-17B/IL-17RB pathway is considered as a signaling cascade that promotes cancer cell survival, proliferation and migration. The pro-tumor functions associated with the IL 17B/IL-17RB pathway are diverse and complex because they involve mechanisms that act directly on tumor cells, and also indirect mechanisms that lead to tumor microenvironment remodeling.

Protocols

Product Specific Protocols
WB protocol for IL-17RB antibody 85961-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...