LAYN Recombinant monoclonal antibody

LAYN Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85900-1-RR

Clone No.250175B7

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Layilin, UNQ208/PRO234

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCAffinity

WB analysis using 85900-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 85900-1-RR (LAYN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
IHC staining of mouse brain using 85900-1-RR
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85900-1-RR (LAYN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of A549 using 85900-1-RR
Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using LAYN antibody (85900-1-RR, Clone: 250175B7 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
Affinity and Kinetic Characterization of 85900-1-RR
Biolayer interferometry (BLl) kinetic assays of 85900-1-RR against Human LAYN were performed. The affinity constant is 7.21 nM.

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Raji cells, HeLa cells, A549 cells, NCI-H1299 cells, A172 cells, mouse brain tissue, rat brain tissue
Positive IHC detected in	mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	A549 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85900-1-RR targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species
Full Name	layilin
Calculated Molecular Weight	382 aa, 43 kDa
Observed Molecular Weight	43 kDa
GenBank Accession Number	BC025407
Gene Symbol	LAYN
Gene ID (NCBI)	143903
RRID	AB_3744457
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q6UX15
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAYN acts as a receptor for hyaluronic acid (HA) and is involved in various cellular processes, including cell adhesion, movement, and signal transduction. In the context of cancer, LAYN has been identified as a prognostic biomarker. High expression of LAYN is associated with poor prognosis and increased immune cell infiltration in various cancers, such as colorectal cancer and gastric cancer. It may also play a role in T-cell exhaustion and the regulation of tumor-associated macrophages (PMID: 30761122).

Protocols

Product Specific Protocols
IF protocol for LAYN antibody 85900-1-RR	Download protocol
IHC protocol for LAYN antibody 85900-1-RR	Download protocol
WB protocol for LAYN antibody 85900-1-RR	Download protocol