Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LDHA Polyclonal antibody

LDHA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cell proliferation-inducing gene 19 protein, EC:1.1.1.27, lactate dehydrogenase A, LDH A, LDH-A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LDHA in ?

Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, human testis tissue, A375 cells, HepG2 cells, NIH/3T3 cells, MDA-MB-231 cells, mouse kidney tissue, rat kidney tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:30000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21799-1-AP targets LDHA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16703

Product name: Recombinant human LDHA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 283-332 aa of BC067223

Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Predict reactive species
Full Name lactate dehydrogenase A
Calculated Molecular Weight 332 aa, 37 kDa
Observed Molecular Weight 32-37 kDa
GenBank Accession NumberBC067223
Gene Symbol LDHA
Gene ID (NCBI) 3939
RRIDAB_10858925
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00338
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087).

Protocols

Product Specific Protocols
FC protocol for LDHA antibody 21799-1-APDownload protocol
IF protocol for LDHA antibody 21799-1-APDownload protocol
IHC protocol for LDHA antibody 21799-1-APDownload protocol
IP protocol for LDHA antibody 21799-1-APDownload protocol
WB protocol for LDHA antibody 21799-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-LDHA antibody (Cat# 21799-1-AP) has accumulated 133 citations published in high-impact journals including Cell, Nature Metabolism, Nature Communications, Molecular Cell, Science Translational Medicine, Science Advances, Cell Death & Differentiation, Developmental Cell, EMBO Journal, and Oncogene. Key research fields encompass glycolysis and the Warburg effect, lactate metabolism, histone lactylation, hypoxia/HIF-1α signaling, tumor progression across multiple cancer types (hepatocellular, colorectal, gastric, pancreatic, breast, ovarian, cervical, glioma, melanoma), ferroptosis, tumor immune microenvironment remodeling, mitochondrial dysfunction, and neurodegeneration.

SpeciesApplicationTitle
mouseWB

Cell

A tissue injury sensing and repair pathway distinct from host pathogen defense

Authors - Siqi Liu
mouse,humanWB

Cell Metab

Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation

Authors - Jian Zhou
mouseWB

Adv Mater

Functionalized Nanozyme Microcapsules Targeting Deafness Prevention via Mitochondrial Homeostasis Remodeling

Authors - Shengjie Ge
humanWB,IF

Cancer Commun (Lond)

Simvastatin overcomes the pPCK1-pLDHA-SPRINGlac axis-mediated ferroptosis and chemo-immunotherapy resistance in AKT-hyperactivated intrahepatic cholangiocarcinoma

Authors - Jinghan Zhu
mouseIF

Nat Metab

Time of exercise differentially impacts bone growth in mice

Authors - Shaoling Yu

Cancer Res

HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.

Authors - Yinghui Li

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Manfred) rated this antibody 5/5 stars after using it for Western Blot on PBMCs. He reported excellent performance at a 1:1000 dilution, recommending an overnight incubation at 4°C. Overall, the feedback is positive, highlighting reliable results and straightforward protocol optimization.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Manfred (Verified Customer) (05-30-2022)

This antibody worked perfectly at 1:1000 dilution. I preferred to do overnight incubation at 4 degrees.

  • Applications: Western Blot
  • Cell Tissue Type: PBMCs
Loading...
||
New chat

Able™

正在加载,请稍候...