Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, human testis tissue, A375 cells, HepG2 cells, NIH/3T3 cells, MDA-MB-231 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:30000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21799-1-AP targets LDHA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16703 Product name: Recombinant human LDHA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-332 aa of BC067223 Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF Predict reactive species |
| Full Name | lactate dehydrogenase A |
| Calculated Molecular Weight | 332 aa, 37 kDa |
| Observed Molecular Weight | 32-37 kDa |
| GenBank Accession Number | BC067223 |
| Gene Symbol | LDHA |
| Gene ID (NCBI) | 3939 |
| RRID | AB_10858925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00338 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lactate dehydrogenase (LDH) is composed of A subunits predominate in skeletal muscle and B subunits are abundantly produced in brain and heart. The LDHA (lactate dehydrogenase A) and COPB1 (coatomer protein complex, subunit beta 1)genes, are involved in energy metabolism and protein transport processes. Both genes might play important roles in muscle development. It has some isoforms with the molecular mass of 27-40 kDa and can form a homotetramer(PMID:11276087).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for LDHA antibody 21799-1-AP | Download protocol |
| IF protocol for LDHA antibody 21799-1-AP | Download protocol |
| IHC protocol for LDHA antibody 21799-1-AP | Download protocol |
| IP protocol for LDHA antibody 21799-1-AP | Download protocol |
| WB protocol for LDHA antibody 21799-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-LDHA antibody (Cat# 21799-1-AP) has accumulated 133 citations published in high-impact journals including Cell, Nature Metabolism, Nature Communications, Molecular Cell, Science Translational Medicine, Science Advances, Cell Death & Differentiation, Developmental Cell, EMBO Journal, and Oncogene. Key research fields encompass glycolysis and the Warburg effect, lactate metabolism, histone lactylation, hypoxia/HIF-1α signaling, tumor progression across multiple cancer types (hepatocellular, colorectal, gastric, pancreatic, breast, ovarian, cervical, glioma, melanoma), ferroptosis, tumor immune microenvironment remodeling, mitochondrial dysfunction, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Cell Metab Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation | ||
Adv Mater Functionalized Nanozyme Microcapsules Targeting Deafness Prevention via Mitochondrial Homeostasis Remodeling | ||
Cancer Commun (Lond) Simvastatin overcomes the pPCK1-pLDHA-SPRINGlac axis-mediated ferroptosis and chemo-immunotherapy resistance in AKT-hyperactivated intrahepatic cholangiocarcinoma | ||
Cancer Res HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc. |
Reviews
What customers say
One reviewer (Manfred) rated this antibody 5/5 stars after using it for Western Blot on PBMCs. He reported excellent performance at a 1:1000 dilution, recommending an overnight incubation at 4°C. Overall, the feedback is positive, highlighting reliable results and straightforward protocol optimization.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Manfred (Verified Customer) (05-30-2022) | This antibody worked perfectly at 1:1000 dilution. I preferred to do overnight incubation at 4 degrees.
|
