Tested Applications
| Positive WB detected in | 3T3-L1 cells, mouse testis tissue, rat lung tissue |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83853-2-RR targets Lipocalin-2/NGAL in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1022 Product name: Recombinant Rat Lipocalin-2/NGAL protein (His Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Sequence: QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN Predict reactive species |
| Full Name | lipocalin 2 |
| Calculated Molecular Weight | 22kDa |
| Observed Molecular Weight | 22-25 kDa |
| Gene Symbol | Lipocalin-2/NGAL |
| Gene ID (NCBI) | 170496 |
| RRID | AB_3671438 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P30152 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neutrophil gelatinase-associated lipocalin (NGAL, also known as lipocalin-2, siderocalin, or LCN2) is a small molecule of almost 25 kDa that belongs to the well-defined superfamily of proteins called lipocalins. NGAL was initially found in activated neutrophils, under its role as an innate antibacterial factor. However, it was subsequently shown that many other types of cells, including those in the kidney tubule, may produce NGAL in response to various injuries. NGAL may become one of the most promising next-generation biomarkers in clinical nephrology and beyond. This antibody recognizes rat Lipocalin-2/Ngal.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Lipocalin-2/NGAL antibody 83853-2-RR | Download protocol |
| WB protocol for Lipocalin-2/NGAL antibody 83853-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Ethnopharmacol Enhancing the efficacy of ulcerative colitis treatment by inhibiting LCN2-mediated pyroptosis through traditional processing techniques: With the rhizome of Atractylodes macrocephala Koidz. as an example. | ||
Neuromolecular Med Exploring Core Genes Involved in Ischemic Stroke and the Therapeutic Potential of Hyperbaric Oxygen: Insights from Transcriptomic Analysis | ||
Toxicol Appl Pharmacol Nuclear protein 1 defends against acute pancreatitis by mitigating pancreatic acinar cell ferroptosis through the maintenance of cellular iron homeostasis. | ||
BMC Gastroenterol Bioinformatic validation of LCN2 as a common hub gene for ferroptosis, pyroptosis and necroptosis in ulcerative colitis. | ||
Food Funct Methionine restriction attenuates renal injury by suppressing macrophage polarization via IRF1 downregulation. | ||
Clin Chim Acta Multi-omics identification of aging-related diagnostic genes and therapeutic targets in renal fibrosis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Benedicte (Verified Customer) (06-04-2026) | IHC staining of mouse colitic colon using 83853-2-RR. Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 83853-2-RR (Lipocalin-2/NGAL Rabbit RecAb ) at dilution of 1:200 (40x on NDPview). Heat mediated antigen retrieval with EDTA 1mM (pH 8.5).
 |
